Web stats for Aurastudia - aurastudia.ru
РђРЈР Рђ РЎРўРЈР”Р
1.67 Rating by ClearWebStats
aurastudia.ru is 1 decade 5 years 9 months old. This website has a #873,409 rank in global traffic. It has a .ru as an domain extension. This domain is estimated value of $ 720.00 and has a daily earning of $ 3.00. While no active threats were reported recently by users, aurastudia.ru is SAFE to browse.
Traffic Report of Aurastudia
Daily Unique Visitors: | 551 |
Daily Pageviews: | 1,102 |
Estimated Valuation
Income Per Day: | $ 3.00 |
Estimated Worth: | $ 720.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Poor |
WOT Privacy: | Poor |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 873,409 |
Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
93
Siteadvisor Rating
Not Applicable
Where is aurastudia.ru server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 217.112.35.74)
Маркетинговое и интернет-агентство WebStar Studio
- webstarstudio.com
Создание сайта
НОУ "Образовательный центр ОАО "Газпром"
- gazpromschool.ru
Рекламное агентство
- g-i.su
Рекламное агентство Джаганнат проводит рекламные кампании с гарантией результата
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.10.0
Date: Wed, 13 Jul 2016 04:15:23 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=20
X-Powered-By: PHP/5.2.17
Content-Encoding: gzip
Status-Code: 200
Status: 200 OK
Server: nginx/1.10.0
Date: Wed, 13 Jul 2016 04:15:23 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=20
X-Powered-By: PHP/5.2.17
Content-Encoding: gzip
Domain Information for aurastudia.ru
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
AURASTUDIA.ru | A | 1795 |
IP:217.112.35.74 |
aurastudia.ru | NS | 1800 |
Target:ns3.valuehost.ru |
aurastudia.ru | NS | 1800 |
Target:ns2.valuehost.ru |
aurastudia.ru | NS | 1800 |
Target:ns1.valuehost.ru |
aurastudia.ru | SOA | 1800 |
MNAME:ns1.valuehost.ru RNAME:noc.valuehost.com Serial:2016071328 Refresh:10800 Retry:1800 Expire:604800 |
aurastudia.ru | MX | 1800 |
Priority:300 Target:relay.valuehost.ru |
aurastudia.ru | MX | 1800 |
Priority:200 Target:mxs2.valuehost.ru |
aurastudia.ru | MX | 1800 |
Priority:100 Target:mxs.valuehost.ru |
Similarly Ranked Websites to Aurastudia
Kiev Apartments - Rent Kiev Apartment in Ukraine
- kievapts.com
If you need Kiev Apartments, Rent Kiev Apartment, Kiev Ukraine Apartments you've found the right place! American owned company.
Ankara Evden Eve Nakliyat Rehberi - Bölgelere Göre Ankara Nakliye Firmaları
- ankaraevdenevenakliyatfirmalari.com
Ankara nakliyat rehberi. Ankara Evden Eve Nakliye Firmalarının Ankara ilçelerine göre listelendiği nakliye rehberi. Ankara ev taşıma firmaları.
KOSGEB Girişimcilik Destek Programı - Girişimcilik Desteği
- girisimcilikdestegi.com
Praxis S.A.
- praxis.pl
Dystrybucja nośników magnetycznych, materiałów eksploatacyjnych do drukarek i kopiarek (atramenty / głowice z tuszem, tonery, taśmy barwiące, papiery / folie) oraz części serwisowych do urządzeń biurowych. Sprzedaż komputerów, urządzeń peryferyjnych
Full WHOIS Lookup for aurastudia.ru
% By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).
domain: AURASTUDIA.RU
nserver: ns1.valuehost.ru.
nserver: ns2.valuehost.ru.
nserver: ns3.valuehost.ru.
state: REGISTERED, DELEGATED, UNVERIFIED
person: Private Person
registrar: NAUNET-RU
admin-contact: https://client.naunet.ru/c/whoiscontact
created: 2008.07.29
paid-till: 2017.07.29
free-date: 2017.08.29
source: TCI
Last updated on 2016.07.13 07:11:31 MSK
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).
domain: AURASTUDIA.RU
nserver: ns1.valuehost.ru.
nserver: ns2.valuehost.ru.
nserver: ns3.valuehost.ru.
state: REGISTERED, DELEGATED, UNVERIFIED
person: Private Person
registrar: NAUNET-RU
admin-contact: https://client.naunet.ru/c/whoiscontact
created: 2008.07.29
paid-till: 2017.07.29
free-date: 2017.08.29
source: TCI
Last updated on 2016.07.13 07:11:31 MSK